SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398579.Spea_3443 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398579.Spea_3443
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-16
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398579.Spea_3443
Sequence length 130
Comment (Shewanella pealeana ATCC 700345)
Sequence
MPFNLSEVQLSNTELELGAKLPHDYREAMKADNGGEASTEEDDWELYPIKDTSDRKRLVR
TCNHIIVETSSCRGFGSFPEGALAIAGNGLGDQMIFLRDNDKFRDIVYLWLHETGEVQEL
ADSFRGIEKL
Download sequence
Identical sequences A8H869
gi|157963257|ref|YP_001503291.1| WP_012156655.1.79101 398579.Spea_3443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]