SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE001761 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE001761
Domain Number 1 Region: 71-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0000327
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.58e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE001761
Sequence length 231
Comment (Oryza indica)
Sequence
MKVYGWLVSPWMAKVLVCLEEAGVEYEVVPLSLTNGDHRRPEHLARNPFGQIPVLEDGDL
TLYQSHAIARYVLGKHKPELLGLGEGGSVEESAMVDMWLEVETHQYEAAVKPIVWHCLVH
QHVGLERDQGVVDESVEKLRAVLEVYEARLSSSSAGRYSYLAGGGSGDRVSLADLSHVPL
MHYFTATEYGGVLGEYPRVKAWWEALLARPSVKKVIAGMPTDFGFGSGNLP
Download sequence
Identical sequences B8A7V2
39946.BGIOSIBCE001761 OsIBCD001614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]