SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE004990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE004990
Domain Number 1 Region: 75-192
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.2e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.38e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE004990
Sequence length 203
Comment (Oryza indica)
Sequence
MADPVKLIGAFGSPFVHRAEVALRLKGVAYEFIHEDLDNKSDLLLAKNPIHKKVPVLLHG
DRAICESLVIVEYADECSRSSWLALWLDGEEQEGLLKETKENLALLEAQLHGKRFFAGDS
VGYLDIVASGLAHWISVVEEVTGVSLMGGADEDDEYPALRRWAKEYTSDETVMQCLPSRE
HLAAFFAAKKDKLKMVAKAMLHQ
Download sequence
Identical sequences 39946.BGIOSIBCE004990 OsIBCD004510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]