SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE007375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE007375
Domain Number 1 Region: 41-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.93e-31
Family PDI-like 0.0087
Further Details:      
 
Domain Number 2 Region: 255-373
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000656
Family Thioltransferase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE007375
Sequence length 430
Comment (Oryza indica)
Sequence
MGQPTLPPVVVVVVLLLLVVVLPATTCGADAGGGGEAEEFQIPRDGRVLELDDGNFDAAV
RAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLAGLSTPIVVAKVNADKYKKLGSKYGVDG
FPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDVSVLESDSAIKSFVEDAGMGFPLFL
GFGVDESLIVEYGAKYKNRAWFSVAKDFSEDMMVFYDFDKVPALVSVNPKYREQSIFYGP
FDDGAFLEDFIRNSLLPLVVPMNRETVKMLNDDGRKVVLMILQDDESDENSPRLIKVLRS
AASANRDLVFGYVGVNQWEEFTETFDVKSSELPTMIVWDKKEEYEIVEGSERLEEGDYGS
QISRFLEGYRAGRTIKKKVGGRSPTLLGVNAVYILVFLVAVLVLLMYFSGQGEEDQQTQD
NEPMKIEDVQ
Download sequence
Identical sequences A2X5Y0
39946.BGIOSIBCE007375 OsIBCD006816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]