SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE007405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE007405
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-30
Family PDI-like 0.00078
Further Details:      
 
Domain Number 2 Region: 337-475
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-29
Family PDI-like 0.0013
Further Details:      
 
Domain Number 3 Region: 253-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.2e-16
Family PDI-like 0.057
Further Details:      
 
Domain Number 4 Region: 156-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000906
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE007405
Sequence length 492
Comment (Oryza indica)
Sequence
MASSTAFAAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQL
APEYEAAAAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHDYAG
PRDAAGIVAYLKRQAGPASVEMAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVA
EKMRADYDFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGF
PTVVTFDTSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFL
IGDVTASQGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVK
SEPIPEVNDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDD
EDVVIAKMDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPG
EATTTESVKDEL
Download sequence
Identical sequences A2X610
OsIBCD006843 39946.BGIOSIBCE007405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]