SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE010633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE010633
Domain Number 1 Region: 109-231
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.98e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 23-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE010633
Sequence length 259
Comment (Oryza indica)
Sequence
MAAAAAAPASSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDK
IKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSE
KQQFAEELLAYTDAFNKASYSSIVAKGDVSDEAVAALDKIEAALSKFNDGPFFLGQFSLV
DIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVNKIHAYTETKQDPRLPEDVTKDE
PTTTCDGDRELVQYIVDKD
Download sequence
Identical sequences B8ALI5
OsIBCD009707 39946.BGIOSIBCE010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]