SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE010646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE010646
Domain Number 1 Region: 24-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000336
Family Glutathione peroxidase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE010646
Sequence length 186
Comment (Oryza indica)
Sequence
MIFAGRAGEAAAAPVEGLAKSLQGVEVFDLSGKAVPVVDLWKDRKAIVAFARHFGCVLCR
KRADLLAAKQDAMEAAGVALVLIGPGTVEQAKAFYDQTKFKGVSAPRQIHKQLYPQAGLK
IIQLYMEGYRQDWELSFEKTTRTKGGWYQGGLLVAGPGIDNILYIHKDKEAGDDPDMDDV
LKACCS
Download sequence
Identical sequences OsIBCD009717 39946.BGIOSIBCE010646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]