SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE014366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE014366
Domain Number - Region: 92-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0373
Family Glutathione S-transferase (GST), N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE014366
Sequence length 146
Comment (Oryza indica)
Sequence
MRSIRAAQALASRSLLLSSRALHGDAASTAAAAAGGGRLGVQPSPPSQASSSSSSRAMPA
GIAGAVSFSLTFATMAAAEAKERPPMDLLPQNVVLYQYQACPFCNKLNVEYIPLNPYVSI
DYPGFNAKSTAENAPRLIAQRLDDQC
Download sequence
Identical sequences 39946.BGIOSIBCE014366 39946.BGIOSIBCE014367 OsIBCD013391 OsIBCD013392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]