SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE015919 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE015919
Domain Number 1 Region: 398-692
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.57e-40
Family Bacterial dinuclear zinc exopeptidases 0.013
Further Details:      
 
Domain Number 2 Region: 176-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.06e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 81-173
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-22
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 
Domain Number 4 Region: 40-78
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000175
Family ECR1 N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE015919
Sequence length 1089
Comment (Oryza indica)
Sequence
MRDLQLSLNQTQRVRLEAALHELQTVAPAAAVTVADTIPVNDEDNILKGHGTSDQDGEVV
ATLCGVVERVNKLVYVRTLRARYKPEVGDIIVGRVIEIAPKRWRLEINFSQDAVLMLSSM
NLPDGIQRRRTAVDELNMRTIFEENDVICAEVRGFQHDGSLHLQARSQKYGKLERGQLLV
VPAYLVKRRKQHFHHLEQYDVDLILGCNGFIWVGEHVVVGENANMMENKLNLSAEVENFT
PLETRKHICRLANAVRVLSALGFTLTVELIIETAEASVSSNIEINNMLGAEFYVQTAERE
SPGHIWSSGVPLSNHGNCWLPGTFIKPVLGGYTCAAAPMPRGRGSSVTTHEKPKVDEAVS
TNEDYGRRRRTPFLLLGLLMVFLHGSWSVYRFQFANLPLPLDAEQAGKRGFSEASALEHV
KYLAALGPHPVGSDSIDLAVQYVYAVADKIKKTAHWDVDVQLELFHTDIGANRMAGGLFN
GKTMLYSNLKHVILRVVPKYLPEAEDNLILVSSHIDTVSTTEGAGDCSSCVGVMLELARG
VAQWAHGFKSGVLFLFNTGEEEGLDGAHSFITQHRWRNSVRFAIDLEAMGISGKSTLFQG
TDHWALESFASVAKYPSAQIASQDVFQSGAIKSATDFQIYQEVGGLPGLDFAYTDRTSVY
HTKNDKMKHLKPGSLQHIGENMLAFLLHAAASPKFMKDAIQAKQEGAEKTKAVFFDILVG
SSYIALIWLVSPAFAYGLMEATLSPARSPKQLKVITLVLALAAPVVSSAGLVIRMVDVII
GSIVRIDRNPGGLPDWLGNVVVSVAIAIVICFTFVYLLSYVHISGAKRTLGFLLCIFFGL
ALALVSSGILPAFTEDIARSVNVVHVVDTTTVNSGNTEPSSYVTLFSNTPGKLTKELVDL
RDEEFSCGRNRAIDFVTFTMKYGCLSYEGTNTGWSKSEVPVLSLKSDSVTNDARQTIISV
DTKSSTRWSLAINKQEIDDFTVHVDSENLVPLGNKSEIDGWHTIQFAGGKDSPTKFQLTL
FWASNSKDAFPKQVESEDHSFLLKLRTDVNRVTPKVGRVLEKLPGWCAPFGKSTSPYTLA
FLTALPVNI
Download sequence
Identical sequences OsIBCD014999 39946.BGIOSIBCE015919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]