SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE016169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE016169
Domain Number 1 Region: 9-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.15e-63
Family Glutathione peroxidase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE016169
Sequence length 168
Comment (Oryza indica)
Sequence
MAAAPSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYK
VQGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPLYKYLKSN
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
Download sequence
Identical sequences B8ASV8
39946.BGIOSIBCE016169 OsIBCD015215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]