SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE016512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE016512
Domain Number 1 Region: 190-300
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.05e-25
Family Glutathione peroxidase-like 0.00078
Further Details:      
 
Domain Number 2 Region: 16-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-20
Family Glutathione peroxidase-like 0.00065
Further Details:      
 
Domain Number 3 Region: 337-382
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000164
Family C1-like domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE016512
Sequence length 448
Comment (Oryza indica)
Sequence
MGETAEGVEAGEKYVSIPQLAGVGTLLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFT
PKLLQIYRKLRNTCKNMEIIFISLDRDEISFLDYFKGMPWLALPFDTGLRQKLCVQFDIE
HIPALIPLSTTLSHGFRVEEDAVKLVEEYGVDAYPFGAKRRSELEGMDDARRQGGNLLQL
LGCKEREYVISADGIKTPISDLNGKTIGLYFGAHWCPPCRAFTKQLREAYDELKALRPGN
FQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTVQELSRIFTIKGIPTLLILGPDGKVFK
TDGRRIISKYGAMAFPFTESRAYELEEVLKKERDSLPHRVRDHRHEHELELDMAKAYVCD
ECQQKGQNWVFSCKQCNFDLHPTYLNNLYSDPKHLPQLHKHFDQSNVATAENSLRFLNGE
PENSDISSIHVAFADLAGKIRGEDDKRD
Download sequence
Identical sequences B8ATV8 B9FCE3
39946.BGIOSIBCE016512 OsIBCD015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]