SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE016613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE016613
Domain Number - Region: 39-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0537
Family Glutathione peroxidase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE016613
Sequence length 88
Comment (Oryza indica)
Sequence
MGEPIVAVAIAMNEAGDDGASMEKKVIYLHLIVLSKLRFTLTDVQTPDPWAYAEKLGHVS
MLMNWCSVCKCQQEQPFLQTHKDSSKTK
Download sequence
Identical sequences B8AUF6
39946.BGIOSIBCE016613 OsIBCD015615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]