SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE017126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE017126
Domain Number 1 Region: 984-1123
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-34
Family Glutathione peroxidase-like 0.0019
Further Details:      
 
Domain Number 2 Region: 275-413
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-33
Family Synaptotagmin-like (S variant) 0.07
Further Details:      
 
Domain Number 3 Region: 436-589
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-29
Family PLC-like (P variant) 0.035
Further Details:      
 
Domain Number 4 Region: 598-737
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-26
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 5 Region: 4-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-23
Family Synaptotagmin-like (S variant) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE017126
Sequence length 1124
Comment (Oryza indica)
Sequence
MAAYKLGVEVASAHDLMPKDGQGSASACVELTFDGQRFRTAIKDKDLNPVWNERFYFNVS
DPSNLPELALEAYVYNINRSVDGSRSFLGKVRIAGTSFVPFPDAVVMHYPLEKRGMFSRV
KGELGLKVYITNDPSIKASNPLPAMDPVSNNPPPTPAEQIAADITSTNLSTTHEHRAEVK
TLHTIAKEVQHQHHGHGHLPASFPDQPSKYAVDPMKPEPQQPKIVRMYSAASQQPMDYAL
KETSPFLGGGQVVGGRVIRAEKHASTYDLVERMQYLFVRVVKARDLPDMDVTGSLDPYVE
VRVGNYRGITRHFEKQKNPEWNAVFAFSRDRMQATILEVVVKDKDLLKDDFVGLVRFDLN
DVPMRVPPDSPLAPEWYRLVHKTGDKSRGELMLAVWIGTQADEAFPDAWHSDAATLEDPS
AVTHMKSKVYHAPRLWYLRVNIIEAQDIAITDKTRYPDVFVRAQVGHQHGRTKPVQARNF
NPFWNEDLMFVAAEPFEDHLILSLEDRVAPNKDEVLGRVIIPLTMIDRRADDRIVHGKWF
NLEKPVLIDVDQLKKEKFSTRLHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLL
ELGILGAQGIVPMKTRDGKGSSDTYCVAKYGSKWVRTRTIVNNPGPKFNEQYTWEVYDPA
TVLTVGVFDNGQLGEKGGEKTSSSKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVK
KMGELHLAIRFSSTSLVNMMYLYSRPLLPKMHYVRPIPVLQVDMLRHQAVQIVSARLSRM
EPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAVSKWFNGVWNYRYRPRYPP
HMNTKISHAEAVHPDELDEEFDTFPTSRSPDVIRMRYDRLRSVAGRIQTVVGDIATQGER
VQALLSWRDPRATAIFVLFCLIAAIVLYVTPLQVLAALAGFYVMRHPRFRYRLPSTPWLV
QESTSVLLKANMGAAESSSKLAGSIHEFTVKDARGSDVELSRYKGKVVLIVNAASRWIGD
IGVPMQSICRTGATEPGSNEQVVEFACTRFKAEYPILGKVDVNGGNAAPLYKFLKSERGG
LFGERIKWNFTKFLVDKEGHVVNRYAPTSSPLSIENDIKNLLGA
Download sequence
Identical sequences 39946.BGIOSIBCE017126 OsIBCD016060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]