SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE017633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE017633
Domain Number 1 Region: 24-83
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000553
Family Ran-binding domain 0.022
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE017633
Domain Number - Region: 123-184,256-520
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family MIF4G domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE017633
Sequence length 704
Comment (Oryza indica)
Sequence
MGEEEQGPRRKQAGPDDAVQTSMQRVKVYRLTDDGKWDDQGTGHVTIDYIEGSREIALTV
VDEEDSDTLLLHHITSDDIYRKQEVQEATPPAAFESLEASRNPPFHDESLSSTSRELKKL
PPLDLSSLSSILKTILECSMTERMRVSVAELILQYHDFFPQLVNLFRTCESSGNMDALHM
IFRLVKGIILLNSSAIYDKIFSDDFILEIIGALEYDPEARTVQNHRTFLKEHVVFKEAVP
IKNASVVSKIHQTYRIGYIKDVILPRVLDDSTMASIAAIIHANNAAVVCLLKDDASFVKE
LFAKMRSSNISAESKRELVLFLLEFCTLTKSLQAVQQLRLSRDLASEGVFDIMSDVLQSQ
DKVLVSAGTDILVYFLNQDPNLLRSYIARQENSQEGNSLLGLLVQGMVTDFGEGMHCQFL
EILKILMDEFATNMPTNYDELLLSHVIKFNSLKPIIEVFVENGDRYNMLHSVVLELLEYI
RKLMESGETTQSISLVDMRKKPEERGLDKEEEDYFNKGSDEEDSDKQTSCAQKESLDKLP
KGSDIRHIPARSKSGGLVDYDDDDEGYNPPPKRAVKADEDDEALVIKRNPVDDKQADGRS
PKKPKMEPRFICSKIVAAASVAGRRSNSADKQGPHPPSSSTKTSEGNGDVGEEGPGSQNL
QHDPGSLDSTHQNGDDCTKDAGNSPSEMTVNTSKATDSEPYSVR
Download sequence
Identical sequences 39946.BGIOSIBCE017633 OsIBCD016509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]