SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE018624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE018624
Domain Number 1 Region: 329-452
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-29
Family Ran-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE018624
Sequence length 472
Comment (Oryza indica)
Sequence
MADEEHAPTSRKRVAGTQINKDNPEPDDDSTEQEMGTFKRASEEVMATRRIVKVRRQQPS
SAPSNPFSAIRFTPSDTSAQATIPVSEPQPSDVITANAKDSSSEKADEGSNGSGKDALPV
TDKSAGSSEVAETEKDGSDLKGSDEKAKSSDSIEPPSQPVETTDEAKDLGGGSVVAGEAK
EDNSKASDIEDKTAKEGDAEEEDGANEAGAEDKISKGDDEKKDGDESETKDGSSEEQKDA
DNKGQSSSPTPLFSFKNLSSGQNAFTGLAGTGFSGSSFSFGSGSKESSSAPLFGLKTDGS
SFPSFSIGASNNGSSSPALATSAEAPKKFAMPEGPVETGEENEKAIFTADSALYEYLDGG
WKERGKGELKLNIPVSGGERSRLVMRTKGNYRLVLNASLYEDMSLKDMDKKGVTFACMNS
IGDSQSGLATFALKFRDTSIREEFKAAVEMHKAKKASGTLKTPENSPKASDD
Download sequence
Identical sequences A0A0E0PL43 A2Y3G8 Q5W645
39946.BGIOSIBCE018624 39947.LOC_Os05g28190.1 LOC_Os05g28190.1|13105.m02902|protein LOC_Os05g28190.1|PACid:21942494 XP_015639973.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]