SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE019375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE019375
Domain Number 1 Region: 68-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.74e-19
Family Thioltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE019375
Sequence length 220
Comment (Oryza indica)
Sequence
MWASWDLQSLLVPPDAALSSSSPSPPRVFHRIRVAACALRVLRNLQSAGQQQQPHAAAAI
WSEPGGGEGARVVLYYTSLRVVRGTYEDCRAVRAILRGLRAAVDERDLSMDPAFLPELAA
LLPHRRHLALPQVFVNGRHLGGAEEVRRLHESGELRRIVAAANPTPASCGRCAGERYVLC
GSCDGSHKRYSHKGGGGFRACAMCNENGLVRCPDCCLPPA
Download sequence
Identical sequences A2Y5M9
OsIBCD018332 39946.BGIOSIBCE019375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]