SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE020978 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE020978
Domain Number 1 Region: 120-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-52
Family Glutathione peroxidase-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE020978
Sequence length 265
Comment (Oryza indica)
Sequence
MAFAVSTACRPSLLLPPRQRSSPPRPRPLLCTPSTAAFRRGALSATTTPTPARAALPSTT
GRNRIVCGKVTTTNNYPSSCRSRRSTMMHAAAWLLLQQLSPAAARVARAADDDSSVQVSK
GSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAE
VIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGV
VQYIYNNQFQPEKHIGETLKILQSL
Download sequence
Identical sequences A0A0E0PUN2
XP_015641441.1.37577 LOC_Os06g09610.1|PACid:21928875 LOC_Os06g09610.1|13106.m01037|protein 39946.BGIOSIBCE020978 39947.LOC_Os06g09610.1 OsIBCD019707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]