SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE021233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE021233
Domain Number 1 Region: 12-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE021233
Sequence length 164
Comment (Oryza indica)
Sequence
MEVVGGIGCQFTLRRAILGPFTQRVLLTIEEKHLPYDIKLVDLANKPDWFLKISPEGKVP
IVKLEEQWVADSDVITQAIEEKYPEPSLATPPEKASVGSKIFSTFIGFLKSKDPNDGTEQ
ALLSELTSFDSYLKDNTIFSMDSFVKTIALQEDVIAGWRPKVMG
Download sequence
Identical sequences OsIBCD019927 39946.BGIOSIBCE021233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]