SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE023723 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE023723
Domain Number 1 Region: 251-339
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.68e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000114
Family Glutathione S-transferase (GST), N-terminal domain 0.00051
Further Details:      
 
Domain Number 3 Region: 28-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000315
Family Glutathione S-transferase (GST), N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE023723
Sequence length 344
Comment (Oryza indica)
Sequence
MHPTPAAAAVTGEHDDDELAACVVVVDFWANRFGMRARIALHVLQVGFGFVEEDLRIRER
SDLVLRMNPVHRSVPILIHRGRPICGSINILQYIDEVWAKRVGTRLLPPDPLKRASARFW
ADFVDHEKRTELTNQLTNGAIKSGWAVMHPTPAAAAVTGEHDDDELAACVVVVDFWANRF
GMRARIALHVLQVGFGFVEEDLRIRERSDLVLRMNPVHRSVPILIHRGRPICGSINILQY
IDEVWAKRVGTRLLPPDPLKRASARFWADFVDHEVFSTQTRFLKSKGEEKEMAKAELLDQ
LRRLEGVLGDRSFFSGDEFGFLDIVLIPFSSRFHGYKQHMVGLI
Download sequence
Identical sequences B8B7C3
39946.BGIOSIBCE023723 OsIBCD022381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]