SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE027251 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE027251
Domain Number 1 Region: 241-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000942
Family B3 DNA binding domain 0.009
Further Details:      
 
Domain Number 2 Region: 425-473
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000235
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE027251
Sequence length 627
Comment (Oryza indica)
Sequence
MSSRDTLPPPDLRHGGGGASDQTNSAVPVSETPMEDGGGAPAAAGSSNTAAPPQPPRLDG
PTLERELRRCNIKLGKQKVSGEASTVTTEPPRKKLMHDGIRAAAAAAPPPRSPPTRRIIS
YMVTAAAPPERKKTAADDRFRNLGTCSAQLRRRLSELDATEPEFVCEKTLRMSDVHRNQN
RLLFSCKRKEDLDQCPITHLFTDKETQIVHKKDEIAVEKKKKKKIKKDEKKKEIKKEEEK
QIREKLGLKVTVFDQGGNEYGMTCRYLESNGGYRFIEGWGKFVETNGMAISDSQRWTRDV
VVKLLAFRSRRLARGAEQSDHPDGPIGFIVLHHENRSRGRGDNDNDNEEEEEEEYQGKAP
PANPKKEKSNGKEEHVVRASTSSSSSSAEAAVGVVAPMHEVSAAPRNMLEEDACLGMEEE
NQIREKLGLKLTVFDQGGNEYGMTCRYLESNGGYRFIEGWGKFVETNGMAISDSQRWTRD
VVVKLLAFRSRRLARGAEQSDHPDGPIGFIVLHHENGSRGRGDNDNDNEEEEEEEYQGKA
PPANTKKEKSNGKEEHVVRASTSSSSSSAEAAVGVVAPMHEVSAAPRNMLEEDACLGMVK
LWSDTGSSSSSSKYNGPESSEEKRKKD
Download sequence
Identical sequences OsIBCD025798 39946.BGIOSIBCE027251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]