SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE028862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE028862
Domain Number 1 Region: 144-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.14e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 316-424
Classification Level Classification E-value
Superfamily LEA14-like 0.0000000602
Family LEA14-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE028862
Sequence length 470
Comment (Oryza indica)
Sequence
MAATALHLPPLLLARRLRFSSAAASTSTSRRTTRLSAQLDDTAAASTSTSTSDKPAAASS
FAPPPDFKPPEPKTFEVKPGQSDDIVTASLAIPFRLGTGVFALGYSVSLVSPDEVAPDEY
ALDFQGRKVKESSKIGQCPRPEKPIEIYEFEGCPFCRKVREMVAVLDLDVLFYPCPKNGP
TFRPKVLEMGGKQQFPYMVDPNTGVAMYESDAIIKYLADKYGDGTVPIMLSLGILTTITA
GLAMSGRSGKGSKYTPAKLPPEPIELWAYELCTRQPQETGIFEEIRHFPGVVGAGARHSW
APPQRRRRRPLLLCRPRDPTFELISISLSTFHFRPPAALDIGLTLTVHATNPNVVPVRYG
PSTVSILYGGAHLGTAHLDAGEQPPTSCRLLHLPARLDAVELAHHARSILADTARRHMEL
DAAVKIAGEAAVALWSRRFSVSIDSHIVVDPVFLDVIEQENHSEMQLYLT
Download sequence
Identical sequences 39946.BGIOSIBCE028862 OsIBCD027398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]