SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE030259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE030259
Domain Number 1 Region: 78-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.09e-41
Family Glutathione S-transferase (GST), C-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.81e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE030259
Sequence length 223
Comment (Oryza indica)
Sequence
MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV
HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG
EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGVEVVTD
EALPLMKAWFDRVLAVDAVKAVLPPRDKLVALNKARREQILSA
Download sequence
Identical sequences A2Z263 Q93WY5
LOC_Os09g29200.1|PACid:21926090 OsIBCD028842 LOC_Os09g29200.1|13109.m02893|protein 39946.BGIOSIBCE030259 39947.LOC_Os09g29200.1 XP_015611712.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]