SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE030926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE030926
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.42e-20
Family Thioltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE030926
Sequence length 109
Comment (Oryza indica)
Sequence
MTIDSWQQLIDSLKGNVVVLEFMAPWSEPSKFMEQPFKEVASEFKDKNSNVKFAALNFDN
SKNLARRLQVEALPTFLVVNNFAVVDRILALSKTELQQKINDKLAQTNY
Download sequence
Identical sequences A0A0D3HA30 B8BEL0
OBART09G19710.1 39946.BGIOSIBCE030926 OsIBCD029409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]