SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE031217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE031217
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-20
Family VPS36 N-terminal domain-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE031217
Sequence length 206
Comment (Oryza indica)
Sequence
MAENPQLFGNGMPVPFYGEMFVLARDGVEFHVDKIPSAPGGHAKTKGTIYLSNIRMVFVA
SKPVGNFFAFDMPLLYVHGEKFNQPIFHCNNISGFVEPVVPENQNRALYSTHTFKILFKE
GGCGTFVPLFLNLVASVRRYNQFEAQSAASMAPRVDPLQAVQTPVDDMMRHAYVDPNDPT
KIFLQQPAPESQLRRRNYHGPADNAY
Download sequence
Identical sequences A0A0D3H8U0 A0A0E0B579 A0A0E0ETR9 A0A0E0IM86 A0A0E0QTP7 A2Z4X8 I1QQD0
OsIBCD029681 OMERI09G11870.1 ONIVA09G17180.1 39946.BGIOSIBCE031217 OGLUM09G16760.1 ORGLA09G0125900.1 OBART09G16150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]