SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE032016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE032016
Domain Number 1 Region: 234-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000326
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 314-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000337
Family Eukaryotic type KH-domain (KH-domain type I) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE032016
Sequence length 402
Comment (Oryza indica)
Sequence
MSPARGGTPEEEGGGADVEKAAAETGGRGTWRHAAFHVATTIATPAAYAPLPFALASLGW
PLGVCSLVTGTLVTWCSSLVVASLWQWNGDKHTSYKLLAKSIFGPWGYWYVSFFQQVASI
GNNIAIQIAAGSSLKAVYKHYHTTDDGAMTLQQFIILFGAFELLLSQLPDIHSLRATRNA
GMNSYCDKKEITVAFSKTKRQEEDEVIWRMVEQGATDDEECGGTNCSAGENRDPGWPGTS
VFRMLIPATKVGAVIGHSGERLRRLCEETKACVRVIGGHFAAAERAVIIFAKEQPDEPKP
PAIDALLRVYECTINDDGLDVRYNNIVVARILTPSEQAASLIGDQGSVINYIKKASKTNI
HVIGNFLTLMHLLEPLVPSIDKFDISGLQLSIYTDAGLWMMH
Download sequence
Identical sequences OsIBCD030567 39946.BGIOSIBCE032016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]