SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE032833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE032833
Domain Number 1 Region: 88-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.24e-42
Family Glutathione S-transferase (GST), C-terminal domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 8-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.65e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE032833
Sequence length 243
Comment (Oryza indica)
Sequence
MAGGGDELKLLGMWASPFALRAKLALSFKGLSYDYVEEDFKNKSDLLLSSNPVHKKVPVL
IHNGKPICESQVIVQYIDEVFPDAGVTLLPADPHDRAVARFWAAYIDEKLFSAWILVFRS
KTEEEKAEAVKQTFAVVEKLEGALSECSKGKPFFGGDTVGYVDVVLGGFVAWVHAIEEVF
GLNQFDAAKTPLLAAWLERFDELDAVKEVMPDIGRLVELAKMRQAQAAAAAAAVAAAAAG
EAN
Download sequence
Identical sequences OsIBCD031269 39946.BGIOSIBCE032833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]