SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE032838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE032838
Domain Number 1 Region: 88-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.00000587
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE032838
Sequence length 231
Comment (Oryza indica)
Sequence
MAGGGDELKLLGMWASPYVLRVKLALSLKGLSYDYVEEDLMNKSDLLLSSNPVNKKVPVL
IHNGKPICESQIILQYLDEAFPGAGATLLPADPHERAVARFWAAFNDDTLLAASQAASWG
KTEEERAEGEKKVVEALERMEVGLRECSKGKPFFGGDTVGYLDVVLGGFLAWVRATDVMR
GVKRFDPATTPLLAAWAERFVELDAAKAVMPDMDKMIEFGKVLQARAAATN
Download sequence
Identical sequences A0A0E0IVE4 A0A0E0R1P4 A2Z9K1
OsIBCD031273 39946.BGIOSIBCE032838 ONIVA10G18330.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]