SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE034230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE034230
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000224
Family spliceosomal protein U5-15Kd 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE034230
Sequence length 155
Comment (Oryza indica)
Sequence
MGSALLPTLRRKPEVDAAIRDTLDKVLVLRFGRADDAACLHLDDILAKSSWDISRFATVA
LVDMDSEEMQVYIDYFDITLVPATIFFFNAQHMKMDSGTPDHTKWIGSFSSKQDFIDVVE
NVLVYSSPQGLRYNHTAVRCMLWFVLVHQEGHDVP
Download sequence
Identical sequences OsIBCD032544 39946.BGIOSIBCE034230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]