SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE035208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE035208
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.2e-22
Family Thioltransferase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE035208
Sequence length 109
Comment (Oryza indica)
Sequence
MAERVARLASERAVVVFTKSGCCMSTAVTTLLGELAVSAAVHELDREPLGKEMEKELARR
LYGSGGRGGPAVPAVFIGGSLVGGTSKVMAMHLKGELVPLLKSAGALWL
Download sequence
Identical sequences A0A0E0F891 A2ZGI2 I1R1V8
OsIBCD046250 39946.BGIOSIBCE035208 ORGLA11G0175000.1 OMERI11G17740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]