SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE035588 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39946.BGIOSIBCE035588
Domain Number - Region: 397-443
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE035588
Sequence length 475
Comment (Oryza indica)
Sequence
MPPRARTLLMPLAAATLLVASTIFLFAATGARWRPADTGLPVPAADFSAAVLESAVTDTT
AAAKELSFVDENGRPDDPASSSAAAARCDPTHAAVRVFMYDLPPEFHFGILGWSPPTDGA
ADAAMWPDVGSGAAAPRYPGGLNQQHSVEYWLTLDLLSSSSPPCGAAVRVADSRDADVVF
VPFFASLSYNRHSRVVPPEKVSRDKELQEKLVRYLMAQPEWKRSGGADHVIVAHHPNSLL
HARSVLFPVVFVLSDFGRYHPRVASLEKDVIAPYKHMAKTFVNDSAGFDDRPTLLYFRGA
IFRKEGGNIRQELYYMLKDEKDVYFAFGSVQDHGASKASKGMHASKFCLNIAGDTPSSNR
LFDAIVSHCVPVIISDDIELPYEDALDYSKFSIFVRSSDAVKKGYLMRLIRGVSKHQWTR
MWNRLKEVDKHFEYQYPSQKDDAVQMIWQALARKVPAIRLKSHRSRRFSRYDRGK
Download sequence
Identical sequences B8BLT2 Q2QYC6
OsIBCD033920 39946.BGIOSIBCE035588 39947.LOC_Os12g03100.1 LOC_Os12g03100.1|PACid:21935202 LOC_Os12g03100.1|13112.m00265|protein XP_015620647.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]