SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g65230.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os01g65230.1
Domain Number 1 Region: 41-341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-85
Family Protein kinases, catalytic subunit 0.000000407
Further Details:      
 
Domain Number 2 Region: 311-331,378-497
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-25
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g65230.1
Sequence length 498
Comment (Oryza sativa)
Sequence
MAVGGDDDMERDFAARLRLAPSPASPNAAAGGGGGGIAFRAPQEQFTVGDFELGKIYGVG
SYSKVVRAKKKDTGNVYALKIMDKKFITKENKISYVKMERIVLDQLDHPGVIRLFFTFQD
TYSLYMALESCEGGELFDQIVRKGRLSEDEARFYAAEIVDILEYLHSLGLIHRDVKPENL
LLTSDGHIKIADFGSVKPTKDTPIKVLPNSTNERACTFVGTAAYVPPEVLNSAPPTFGND
LWALGCTLYQLLSGSSPFKDASEWLIFQRIIARDLKIPEYFSDDARDLIDKLLDVDPSKR
PGAGPDGYVSLKKHPFFRGIDWKNIRSTRAPKLAMEANANEDEDSQDSSWLSHMGSAPVN
QHVSPVGNDGASSSSEVRSHISRLASIDSFDSRWQDFLEPGESVVLISKLKKINKLTNKK
VQLILTDKPQLICVDPGKMVTKGNIMWSDDPSELNVQVSNSSHFRICTPKKVSSFEDAKQ
RAWQWKKAIEDLQRCQKN
Download sequence
Identical sequences Q8RUE8
LOC_Os01g65230.1|13101.m07044|protein XP_015622220.1.37577 LOC_Os01g65230.1|PACid:21904761 39947.LOC_Os01g65230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]