SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os01g72030.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os01g72030.1
Domain Number 1 Region: 358-390
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000119
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 
Domain Number 2 Region: 456-554
Classification Level Classification E-value
Superfamily Acid proteases 0.000000657
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os01g72030.1
Domain Number - Region: 10-74
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0453
Family FCH domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os01g72030.1
Sequence length 767
Comment (Oryza sativa)
Sequence
MSGTSSDEPTLENLAHKLKGMENWYEELMRNSKSYKESTDKHLKTLSESLVKVVDQIEQM
NRSHKQLTENIQNINIGHENIVRRIGLLEAVGEEGVGATAHRHQRYDDEDEEQSVADDEE
EDESVGNRRRCRIRDKDDPLSKVKFTMPSFDGKFEPSVYLDWELAVEQKFSCYDFPDNKK
VKAASSEFTSFASLWWNDICGRGLRPRTWDDMKRTMRSRFVPSYYARDMLNKLQLLRQGS
NSVETYYQEMMIALSRCNLQETEDARISRFYGGLNREIRDILEYKEYNTMNRLFHFACKA
EREVQGRNKHRSSLAGATSTRQSTPRQSTTVVRPPTSTPSHAQETSKNASVQTPAKSATS
VDSTGRTRDITCHRCHGIGHIARDCPNRRALFVNADGEYTSASDCDDEYALAATDHAGGQ
DDEDIEEVHLHPESLDQYPSLIVKLALSAKEKCEEQNQRHNLFQSKVLVKGHTVKMIIDS
GSCNNLASEEMVKKLGLTTHPHPHPYHIQWFHTCGKMKVTRLVKIPFSIGSYHDQIECDV
VHMQACSVILGRPWQYDREVVFDGRTNTYKFMFDGKRVVLHSMTPAAALKDDLARLECEK
KAKSENQIIAKHPASTSKIEPSTTKNEIKLKGALLASKYNICALDEPDSCCYALFCKDPI
LTLATAPSTLYSLPPAITNLLQEYEDVFHDEIPPRMANGRESAHNQEDGIESRTTPIQEG
EDDEDITSSDMLITSHAPMIIPSPSPARPPETALTSNGPSAFMPTPI
Download sequence
Identical sequences Q2RBB2
LOC_Os01g72030.1|13101.m07848|protein LOC_Os11g02590.1|13111.m00189|protein LOC_Os01g72030.1|PACid:21905792 LOC_Os11g02590.1|PACid:21947732 39947.LOC_Os01g72030.1 39947.LOC_Os11g02590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]