SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g31080.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g31080.1
Domain Number 1 Region: 28-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.11e-30
Family BAR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g31080.1
Sequence length 623
Comment (Oryza sativa)
Sequence
MKSPLLRLKGFGHHQQHRERKSRQPQPQPTPAKLDELADAAQDVEEMRNCYDGFISAAAA
TTNGVYEFAEALEELGSCLLAKPVLNDDDDDSGRVLMMLGKAQYELQKSADRYRTNIIHT
ITTPSESLLKELQTLEEMKQQCDMKRDAYETMRASYSDKGGSRHSKTESFSTEQLDASFL
EYQEDSALFTFRLKSLKQGQFQSLLTQAARHHAAQLSFFRKGLKCLEALEPRVKAISEKH
HIDYNFSGLEDDGSDNDGYSTYDSCSDDGELSFDYEINDRDQDFLTSRGSMDFDKSDQTT
SPKPIKENKQEEAKQAEAEIVFPQLKPEFATHSAPLFAGNLLDETDRLRQMRPSSTKHSY
RLPTPVGADNPVPSGSHRLHHSAQFFETKPHAPTNLWHSSPLTKDYNGAMHNAATKPSSS
SSTDDLKKLKRESWSGPIPIKAGSGGKPFSQADHRPSPTMAYPGAMPAAKPHVRHASSSS
VSPKVSPKMSPVPPASSLKISELHLLPLPPANVDPVRPSGLVGYSGPLVSKRAPTPARAS
PKASRTASPLPRPPAALARSYSIPSNSQRTPIITVNKLLEAKHSREGSDASSPPLTPLSL
SDLCHQEKAGKAAAGNTRRKETL
Download sequence
Identical sequences Q67UP1
XP_015627747.1.37577 LOC_Os02g31080.1|13102.m03401|protein 39947.LOC_Os02g31080.1 LOC_Os02g31080.1|PACid:21921895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]