SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os02g44040.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os02g44040.1
Domain Number 1 Region: 265-383
Classification Level Classification E-value
Superfamily PH domain-like 0.00000215
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os02g44040.1
Domain Number - Region: 141-198
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0824
Family A middle domain of Talin 1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os02g44040.1
Sequence length 401
Comment (Oryza sativa)
Sequence
MEGHMLGRMRRRDHLLLMDAAPPPAAVAAAVQTLMEPMEFLSRSWSVSASDISRVLTGGV
GARRSTNFVVDRLSGMLMPETLALAAASSTNLSPRKRYSRCRSAISAHQHTIGRWFHHRD
GSSSSSSSRVDKARAERARVHAAVTVASVAAAVAAVASGAANDPDDLDDAKMDAALASAT
QLLASHCIEIAELAGADHDQVASAVEAAVDVRSPGDLMTLTASAATALRGATALRLRAQR
EARSKVAAVAPYEKTGSCRGDIWCKEGTLLKRSRKGALHRKRVAVYINKKSQVIVKLKSK
HIGGAFSKKKKSVVYGVDDDVQAWPAPHACGGGAVPPAPETASSEKCQFGLRTAQGVVEF
QCESRAQKQDWVESVKNLLRQAAGGTAQLEHSFESLRLSAS
Download sequence
Identical sequences Q6H686
LOC_Os02g44040.1|PACid:21919502 LOC_Os02g44040.1|13102.m04900|protein XP_015624951.1.37577 39947.LOC_Os02g44040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]