SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g17070.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  39947.LOC_Os03g17070.1
Domain Number - Region: 70-183
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family BAR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g17070.1
Sequence length 211
Comment (Oryza sativa)
Sequence
MATAMMAATATSCSPRRAPVVASSSVQPPRRQQQQQPRRGLKQLPGLVATAAVAVAAAPL
PALAEQMEKAALFDFNLTLPLIATEFLLLMVALDKLYFTPLGKFMDERDAKIRAELGGVK
DASEEVRQLEEQAAAVLKAARAEIAAALNKMKKETTQELEAKLDEGRRRVEAELVEALAN
LEAQKEEAVKALDAQIASLSDEIVKKVLPSA
Download sequence
Identical sequences Q84PA4
39947.LOC_Os03g17070.1 LOC_Os03g17070.1|PACid:21915204 LOC_Os03g17070.1|13103.m02041|protein XP_015630476.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]