SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g20900.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g20900.1
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily Homeodomain-like 6.45e-18
Family GARP response regulators 0.0025
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os03g20900.1
Domain Number - Region: 140-206
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0555
Family IMD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g20900.1
Sequence length 354
Comment (Oryza sativa)
Sequence
MYHHQQQLQSHNQLLPSRQSFPSERHLLMQGGSVSGESGLVLSTDAKPRLKWTPELHERF
VEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRLSKNLHAQANAGNVKNALVC
TTATEKPSEANGSPVSHLNLGTQTNKSVHIGEALQMQIEVQRRLHEQLEVQRHLQLRIEA
QGKYLQSVLEKAQETLAKQNAGSVGLETAKMELSELVSKVSTECLQHAFSGFEIESSQML
QGHTMHLGDGSVDSCLTACDGSQKDQDILSISLSAQKGKEIGCMSFDMHVKERGSEDLFL
DKLNRRPSNHPERCERRGGFSMSCQTANLDLNMNDTYDGPKHCKKFDLNGFSWA
Download sequence
Identical sequences Q10M30
39947.LOC_Os03g20900.1 LOC_Os03g20900.1|PACid:21912206 LOC_Os03g20900.1|13103.m02504|protein XP_015627784.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]