SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os03g46340.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os03g46340.1
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Weak hits

Sequence:  39947.LOC_Os03g46340.1
Domain Number - Region: 261-305
Classification Level Classification E-value
Superfamily BAS1536-like 0.0471
Family BAS1536-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os03g46340.1
Sequence length 500
Comment (Oryza sativa)
Sequence
MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWVILDPTSGK
MEYKIRRNETAIKGTIIFDASSTITLSPVNFQGMPKYDGCCFYIGTPQKKDYFLCAETPG
AAKAWVSTLLATQLVLQAHKEAVNSLAGNGSPATLGTVATAVANANATALEATKEIEAAM
KVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQNLAKDIRARDATIKEIANKLTE
TAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQMEQSMLKLRQSEEKVISLSKEKDQ
LLKERDAALQEAHMWRTELGKAREQAVIQEATIARADEKVRASEADAAARIKEAAEKLHA
VEKEKEELLSLVGILQSQVQREQSSTKQVCEERSESCSGTDNSPPLTKHVDASDDDVDKA
CVSDSRSVLVSNDNTEVQLAVDGVDIRPIGDAEWGSFQQSEALIADVREVSPESEGGSLD
IPVVNPPPVSDHIQGGATHP
Download sequence
Identical sequences B8ANN2 Q75H96
39947.LOC_Os03g46340.1 XP_015630802.1.37577 LOC_Os03g46340.1|PACid:21914493 LOC_Os03g46340.1|13103.m04986|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]