SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os04g49430.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os04g49430.1
Domain Number 1 Region: 223-607
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-89
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 2 Region: 609-677
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.84e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 14-93
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000799
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os04g49430.1
Sequence length 1041
Comment (Oryza sativa)
Sequence
MAGSFDGRMPTRGVEQAIVALKKGAHLLKFGKRGKPKFCPFRLSSDEKTLVWYSKDREKH
LSLNSVSTVVLGQKTICRDRDQAECWFLGLTALTSSPYSPLPLAGSKSGRQINSCAISPR
SYLQRKCRLSAALDTPRHTQVYPSYGSPKIQKKIFGGNLDSSEALFYPRHPTSCDIDSYI
EKLNPKIATPVKHGLKDIMVANRRAQNITHTPKLKTFEGPRVACRLDSLKDVFLWGSVLG
SMLGSEDIPKSLPRLVGSAKMLDVQSIACGENHAAIITKQGEVYTWGSYSSGRLDQKVNV
NASCPKMVESLASVHVKAVAFGSKHTCAITVSGELFEWGEGAHSLGLMNDWYGRNQWFPH
KFLGPMDNISVSKIACGEWHTAIITSSGQLFTYGDGTFGVLGHGDTQGVARPKEVESLKG
SRVKSVACGPWHTAAIVEVMSSFKGNAPSGKLFTWGDADRGKLGHADRKMKLLPTCVDSL
TAYDLIQVSCGTAVTVVLTVTGMVFTIGSSRHGQLGNPKADGESICSVEGPLKTEFVREI
SSGSSHVAVLTMSGKVFTWGKGAEGQLGLGDYSNRSSPTLVEALEGRDVESVVCGFNFTA
AICLHKTMSMKDQSVCSSCQMVFGFTRKEHNCYNCGSMFCSSCTSNKITMAALAPDTNRR
YRVCDACFYQLQKVVDSSKDKSRLKISKGEMFKLELKAYTPKLSRLFKEANFFAEKMASV
QGTNQRNEEPATAVQTKTERWGQVECPALFISAQDSFQTQPVSNSEGCAISFSQRMHDSA
VLKSGVSLRFTDAQREEIEMMQTELQGQVKQLHSQVAVLTEQCQQKSVMVQLYKQKLDDT
WLVVRDEAARCKAAKDIIKVLTDQCNALSEKLSIGQLSENSKITPNSIPMQPTKIELQGN
TGRNLVTRKLGQLNNTQNHGSSIQTEKECVPLSNAVVPEDVPFSQQNGARKFSSDGYTTE
APLAAPPTDSVTEQIEHGVYVTFSTSSCGKKDIKRIRFSRKHFGEKEAQHWWEHNKTRVY
DNYKVEQMATPSVTLSCSSTR
Download sequence
Identical sequences Q7F9W1
LOC_Os04g49430.1|PACid:21897668 39947.LOC_Os04g49430.1 LOC_Os04g49430.1|13104.m05044|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]