SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os05g01500.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os05g01500.1
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.06e-28
Family Cap-Gly domain 0.00084
Further Details:      
 
Domain Number 2 Region: 122-369
Classification Level Classification E-value
Superfamily L domain-like 1.11e-20
Family Internalin LRR domain 0.011
Further Details:      
 
Domain Number 3 Region: 455-543
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000296
Family Ubiquitin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os05g01500.1
Sequence length 546
Comment (Oryza sativa)
Sequence
MAAVAFRLGQRVHAAGDPARVGTVRYLGPVDGHPGDWLGVDWDAGAGGRHDGSLAGRRYF
VAAGERSASFARPTALSAGITLPDAIRNRYRVEEFTKEEQDEMYVFSSSQKRVSVELVGK
NKVEEKLKNLNDLTSASVSYMGVSSIGPGDELKNLVPNLRQLDLTGNLLSQWQDIFSLCE
ALASLEILDLTNNTMENDFTDSSSVKNIRVLVLNYCGVTWELVEKIKVSFSCLSELHLMT
NRIKAMMTPVGNIVQGFDTLRLLNLEDNHIDSWDEIVKLSYLRSLEQLHLNKNMLKHVTY
PSNPPPLGSLGDAAVLPFEKLRVLLLGSNQIDEVLSVDSLNLFPSLTLWLSTPILISTFL
KDVRLSDNPVADPAKGGVPRFVLIARLGKVKILNGSEISPRERREAEIRYVRLVMGKAES
YDPEEIKRLHPRFAELKAFHGIEDEKPSSRTSGPQKMASGLISITLKCVGPSMGEKQPLT
KKLPPATTVGKLKSLCESFFKLKDVKLRLYLEEEGCPMPQFFEEDTVSLMELGIGTGSTI
IVDEES
Download sequence
Identical sequences A0A0E0PGE5
LOC_Os05g01500.1|13105.m25154|protein 39947.LOC_Os05g01500.1 LOC_Os05g01500.1|PACid:21943960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]