SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os05g11990.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os05g11990.1
Domain Number 1 Region: 284-479
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.98e-28
Family Thioltransferase 0.0062
Further Details:      
 
Domain Number 2 Region: 19-351
Classification Level Classification E-value
Superfamily TPR-like 8.73e-27
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os05g11990.1
Sequence length 481
Comment (Oryza sativa)
Sequence
MSAAASAEAEEVRRAGNEQYKNGCFEEALRLYDRALALCPDSAACRANRAAALIGLTRLG
EAVEECEEAIRLDPSYGRAHQRLASLQIRLGRTADARKQIGMGGLQPDIVELHKLEAVDK
HLGRFADARKIGNWKSALRECNAAIAAGADSCAMLFASRAEALLQINQLDEADLAISRAS
KLDCSSSCSQDMMFCGFQSNSYLYYVHAQVDIAFGRFDSAMSSMEKARKIDSGNVEVMAM
HKSVRTVAQARTLGNELFHSGKFAEAFLAYGEGLKHHPANSVLYCNRAACMFKLGQWEKS
IEDCNEALKIQPNYWKALLRRAASYGKIEQWADSVKDYEVLRRELPGDTEVAEGHFHALV
ALRSSRGEDVSNMKFGGEVEALVGAEQFQMATTLPGVSVVHFMAPLNQQCSDIAPFVDAL
CTRYPSVNFLKVDITENPTVTQLENVKTVPTFKIYKDGTRVMEMICPSHQLLESSLRQYE
V
Download sequence
Identical sequences 39947.LOC_Os05g11990.1 LOC_Os05g11990.1|PACid:21942492 LOC_Os05g11990.1|13105.m01300|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]