SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os07g14580.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os07g14580.1
Domain Number 1 Region: 25-145
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-46
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os07g14580.1
Sequence length 382
Comment (Oryza sativa)
Sequence
MAHGGGGRAKVTPNLAMDEEGTRVLNITVLQRLDPAVEDILITAGHVTLYDFDTNLNQWS
RKDVEGSLFVVKRNAQPRFQFVVMNRRNTDNLVEDLLGDFEYQLQVPYIMYRNAAQEVIG
IWFYNSQECEEVANLFSRILNAFSKATPKPKAPSIKSEFEELEAAPTLVEGPLEPQTSNI
IPATTHVQEDPLSAFFSGAINVGSASGLSVAGQLNQSFGSTPLSSHAPTSISISQPPAVH
HLLPSQTSSVISPDVHGGTGAVVNRSASLLNPSLFSPLTSSQTTMARTNPVAPTAPPQHP
RITQQPHSAPLLQPFPLPTASPSPPYGTPLLQPFPPPNPSPSLASAPVYSPVLSREKVRD
ALLRLVENDDFIDLVYREIVKG
Download sequence
Identical sequences A0A0E0Q673 Q7XHS7
LOC_Os07g14580.1|PACid:21898351 XP_015644895.1.37577 LOC_Os07g14580.1|13107.m01530|protein 39947.LOC_Os07g14580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]