SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os07g37310.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os07g37310.1
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-55
Family Atu2684-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os07g37310.1
Sequence length 273
Comment (Oryza sativa)
Sequence
MAPRLLSCFGRGSATASAPDQPEEAAAAAAPGPVLLELFCSQGCGASPEADAVAARMVHE
DQQRAAAGEGGGGERGVVVLGFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLDTLFTP
QAVVQGRAHCVGTEQDALAQAVRDAPRYPAPAMKVTFQRPNPSTLQASFTGTLRSRMEGG
GSVLVALYESGLVTDCGRGENKGKSLLNDHVVRRLEKVAAVRDGASAKKSVSGSVQFPLW
DGFRASRCGLVLFVQNAALQVLGVQHFDLPDNV
Download sequence
Identical sequences A0A0D3GSD3 A0A0E0I2B2 A0A0E0Q9V1 A2YML6 Q6Z402
LOC_Os07g37310.1|PACid:21900955 OBART07G18540.1 ONIVA07G16930.1 OsIBCD023884 XP_015645139.1.37577 39946.BGIOSIBCE025231 39947.LOC_Os07g37310.1 LOC_Os07g37310.1|13107.m03838|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]