SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39947.LOC_Os08g42530.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39947.LOC_Os08g42530.1
Domain Number 1 Region: 6-241,289-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-62
Family BAR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 498-637
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.07e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00023
Further Details:      
 
Domain Number 3 Region: 292-436
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-22
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 736-818
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-22
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39947.LOC_Os08g42530.1
Sequence length 831
Comment (Oryza sativa)
Sequence
MLFAKLDDSPMLRTQIQSLEESAEILRERCLKFHKGCRKYTEGLGEAYDGDIAFASSLET
FGGGHNDPISVAFGGPVMTKFTIALRELGTYKEVLRSQVEHMLNDRLLNFVDIDLHDVKD
ARKRFDKASLLYDQVRDKYLSLKKGTRADITTAIEDELHNARSSFEQARFNLVTSISHIE
AKKRFEFLEAVSSTMDSHLRYFKQGYDLLHQMEPYINQVLAYAQQSRERANKEQASLVER
MHEYKKQIDREIRLSNGLTDAHNGDGIQTIARSSHKMIEAVMQSASKGKVQTIRQGYLSK
RSSNLRADWKRRFFVLDSRGMLYYYRKQINRTPGGCSSHPRSIGNPTEHGSGLLSRLFSS
HYHGIIHDEKSVARHTVNLLTSTIKVDAEQSDLRFCFRIISPTKVYTLQAESAIDQMDWI
EKITGVIASLLSSQSPEQCFLLSPKSCGHDGSASESSSFTSQDLEPSMYDDLTLEKNTGN
GQHDVRGTHYHKTNMKPEKPIDLLRKVDGNIICVDCGSMEPDWASLNLGALLCIECSGVH
RNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNKFVNDVWEEVLPSSKNGESDDKLRAHG
LDTAWHFTVSKPKHSDPFSAKEKFIHAKYADKEFVRKYSMDEIQLAQQMWDNVTANDKRA
VYSLIVQSRANVNLVYGEMSYSSRSTTGRSSQQEHSSSPSDGSPVFFDCHSHEKVSPREP
LSPASTSSRVDDGEERCEGFSLLHLACHVADVGMVELLLQYGANVNAIDSRGRTPLHQCI
LKGRHIHAKLLLSRGANPQVADQDGRTALQCAIDGGTSDDEILVLLEDYTR
Download sequence
Identical sequences Q0J435
LOC_Os08g42530.1|PACid:21887553 XP_015648272.1.37577 LOC_Os08g42530.1|13108.m04583|protein 39947.LOC_Os08g42530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]