SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399549.Msed_0076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399549.Msed_0076
Domain Number 1 Region: 65-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.18e-18
Family Cold shock DNA-binding domain-like 0.0000335
Further Details:      
 
Domain Number 2 Region: 6-63
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000000237
Family ECR1 N-terminal domain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 151-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000209
Family Eukaryotic type KH-domain (KH-domain type I) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399549.Msed_0076
Sequence length 247
Comment (Metallosphaera sedula DSM 5348)
Sequence
MSTENKIYLQDRTVVVPGDLIAEGNFQIPWSPYVIKQGNKYYASVIGVVEVKDSIFEVIP
LEGSHYYPRIGDTVIALVEDVELYGWTTDIKAPYSAYLPASSLLGRPANVGEDLRRYIDV
GDYVIAKVESFDRTSDPVLSVKGKGLGRVSSGTVIDILPVKVPRVVGKGKSMLETLSTET
GCDILVAQNGRVLANCPSKEKENVLIMAIRTIERESHTKGLTDRIKKLIKESLGDNSVTS
SEAQTNT
Download sequence
Identical sequences A0A088E4G3 A4YCV1
WP_011921222.1.15515 WP_011921222.1.27320 WP_011921222.1.28583 WP_011921222.1.31166 WP_011921222.1.34633 WP_011921222.1.8883 WP_011921222.1.99084 399549.Msed_0076 gi|146302861|ref|YP_001190177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]