SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399550.Smar_0044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399550.Smar_0044
Domain Number 1 Region: 41-189,217-236
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.54e-22
Family ATP-dependent protease Lon (La), catalytic domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399550.Smar_0044
Sequence length 655
Comment (Staphylothermus marinus F1)
Sequence
MQYLRLVSSMLVFLIILSAIFMVNAYPANITIHTFRKSVVVYAPAVTRSGEGAVLRVNLT
IVYPGSGMVYFSARPLVEPDTQATARIAAYVASTVTGQNFYSYDYYVVMTSNSLVVGGPS
AGGLMTIGFISLFLNKTLNPNVTMTGMINPDGSIGPVGGLLGKLHAVAKSGFKVFLIPVG
QRIVYVEKRIVKRVLWGYYETIKYVPVDLVKEGEKLNVTVIEVGNIFDAMKYFLGVNVKP
IKSSKIIMNNTVLNIIDKFAWENYVRSMNLFNESKKLFNQLDLFTRIQLYDQIKNVEKMN
YQLKQLIDENLSIASFIYSNKVLKENIYINWLYKSILGKLNLENTISMINETIKDLHDKL
STTGPGLNPLLIESHGLYFQALTNYIELLSKNNASFTTGDIEKLADVAVKLYFSDQLLNI
SSMFSKKYINITDSFMTLYSLSDSVVSYAYSLANDIGGGNQYIVEALNYFQDAINAYTTN
YTVASIGLLIDSIVYADIGIETLFIQNNTVYSNITMYLMREHLIYYNLTTIKDYMNYTFM
ASNQYMYINDYVDSMYTLLKGIMYASIFMSNNTSLNIVENTVFLPSSTPVNNPNNRTETP
TSRSTSNSTRINEINTNIQDTVYYVLGLITGFALGLITYYIYSVTKRKKGESLNI
Download sequence
Identical sequences A3DKJ7
gi|126464956|ref|YP_001040065.1| WP_011838348.1.69113 399550.Smar_0044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]