SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399599.Sbal195_3338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399599.Sbal195_3338
Domain Number 1 Region: 133-391
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-82
Family Subtilases 0.00000637
Further Details:      
 
Domain Number 2 Region: 40-119
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000346
Family Subtilase propeptides/inhibitors 0.0027
Further Details:      
 
Domain Number 3 Region: 530-617
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000562
Family Collagen-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  399599.Sbal195_3338
Domain Number - Region: 426-515
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00051
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399599.Sbal195_3338
Sequence length 629
Comment (Shewanella baltica OS195)
Sequence
MHKKHLIAVAVATGLAYFPVNANEYQATMVSVPQSKAIKDTYIVVFNTPSVLNLSNNNTI
AEFAVQQAESLVNQYDVRVMKNFGNVLNGVLINASAQQVKALLKDPNVKYVEQDQVMSVT
PMMEANADQPSPTWGIDRIDQRNLPLDNNYHTDYDGSGVTAFVIDTGVLNTHNEFGGRAS
SGYDFIDNDYDTTDCNGHGTHVAGTIGGSTYGVAKNVNVVGVRVLNCSGSGSNSGVIAGI
NWVKNNASGPAVANMSLGGGASQATDDAVNAAVAAGITFVVAAGNDNSNACNYSPARAAD
AITVGSTTSNDSRSSFSNYGTCLDIYAPGSSITSSWYTSNSATNTISGTSMASPHVAGVA
ALYLDENPNLSPAQVTNLLKTRATADKVTDAKTGSPNKLLFSIANDDGGCGNDCPVDETQ
LQNNVGIAISGATGSATYYYIDVPANAASLGINLAGGSGDADIYVSQGQKPTTTSYQCRP
YQNGNNESCNFTAPTAGRWYVMVQGYSNYANAQLTASYNLNGGGNCTDANCLTNGVPVTN
LSGATGTEALYKIVVPANSQLSITTSGGTGDVDLYVKAGTVPTTTSYDCRPYKNGNNESC
SITVTQAGTYHVMLRGYANYSGVQLSASY
Download sequence
Identical sequences A9KZ52
gi|160876444|ref|YP_001555760.1| gi|378709645|ref|YP_005274539.1| WP_012197479.1.60405 WP_012197479.1.93117 399599.Sbal195_3338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]