SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_0711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_0711
Domain Number 1 Region: 98-228
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.63e-24
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.79e-18
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_0711
Sequence length 243
Comment (Serratia proteamaculans 568)
Sequence
MKTAPTTLSETLTQDLARRIIRGDLPPGLSLPGENELAQQYEVSRTSVRNALQVLAAKGL
ISIQAKKRSTVNSRQQWSFLDTDVLAWLAEDSLDPLLIEQLMVTRLIFEPNIAALAAVNA
TGHDLAALEDACKLMAQGQQQASRELFEQGDMAFHLALLGASHNPFLHSLGSALSAAMAL
SFQQTLEEDVRLAQKAVEEHQQLLEAIRFKQVENARQCMRVILLNAARKNNWHKQPEMFA
HIL
Download sequence
Identical sequences A8G9M7
399741.Spro_0711 gi|157368956|ref|YP_001476945.1| WP_012005162.1.18676 WP_012005162.1.35080 Aqu1.203173|PACid:15701701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]