SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 401614.FTN_0597 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401614.FTN_0597
Domain Number 1 Region: 47-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.34e-20
Family Thioltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 401614.FTN_0597
Sequence length 255
Comment (Francisella tularensis novicida U112)
Sequence
MKKLLVTLGISSVLILSSCANHQNIQAQEASVNHKTSNDYAKIIAIPDIVKDLLSDPATP
TVGPQDANKAVVVFFDYGCGKCAEISKEINKLMKENPNVKFIFKAYPSLKRDAKVANYAS
LVANEAYLQGGSELFLAYNKAIFAQRETNGELTVQDVDNVVKRLGIKVNDTKLKQKAAAE
ELDTRKLGKLIGFQGPHSFVILPTNLASMNANDLGNNVDKVYVISDKQTNVITDNYQQAA
KWVATNIQAQLNNIK
Download sequence
Identical sequences A0Q5H7
WP_003038655.1.11577 WP_003038655.1.21561 WP_003038655.1.72761 gi|118497196|ref|YP_898246.1| 401614.FTN_0597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]