SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 401614.FTN_1435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401614.FTN_1435
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-29
Family ArsC-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 401614.FTN_1435
Sequence length 139
Comment (Francisella tularensis novicida U112)
Sequence
MDYFYDFYTNVIYNCSYSKNIINVMKIYHNPKCSKSRQAKQILDQNNIDYEIHLYLDKPL
SKDQVIVLLQKLKLSIKDIIRTKENIWKENFSDKEFTEAELIEIVVANPGLLERPIIENG
DFAVVARSDEKIQQILNTY
Download sequence
Identical sequences A0Q7T8
401614.FTN_1435 gi|118498007|ref|YP_899057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]