SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402882.Shew185_3194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402882.Shew185_3194
Domain Number 1 Region: 133-391
Classification Level Classification E-value
Superfamily Subtilisin-like 4.06e-82
Family Subtilases 0.00000656
Further Details:      
 
Domain Number 2 Region: 40-119
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000346
Family Subtilase propeptides/inhibitors 0.0027
Further Details:      
 
Domain Number 3 Region: 531-617
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000732
Family Collagen-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  402882.Shew185_3194
Domain Number - Region: 426-515
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000549
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 402882.Shew185_3194
Sequence length 629
Comment (Shewanella baltica OS185)
Sequence
MHKKHLIAVAVATGLAYFPVNANEYQATMVSVPQSKAIKDTYIVVFNTPSVLNLSNNNTI
AEFAVQQAESLVNQYDVRVMKNFGNVLNGVLINASAQQVKALLKDPNVKYVEQDQVMSVT
PMMEANADQPSPTWGIDRIDQRNLPLDNNYHTDYDGSGVTAFVIDTGVLNTHNEFVGRAS
SGYDFIDNDYDATDCNGHGTHVAGTIGGSTYGVAKNVNVVGVRVLNCSGSGSNSGVIAGI
NWVKNNASGPAVANMSLGGGASQATDDAVNAAVAAGITFVVAAGNDNSNACNYSPARAAD
AITVGSTTSNDSRSSFSNYGTCLDIYAPGSSITSSWYTSNSATNTISGTSMASPHVAGVA
ALYLDENPNLSPAQVTNLLKTRATADKVTDAKTGSPNKLLFSLENDDGGCGNDCPVDETQ
LQNNVGIAISGATGSATYYYIDVPANAASLGINLAGGSGDADIYVSQGQKPTTTSYQCRP
YQNGNNESCNFTAPTAGRWYVMVQGYSNYANAQLTASYNLNGGGNCTDANCLSNGVPVTN
LSGATGTEALYKIVVPANSQLSITTSGGTGDVDLYVKAGTVPTTTSYDCRPYKNGNNESC
SITVTQAGTYHVMLRGYANYSGVQLSASY
Download sequence
Identical sequences WP_012089852.1.85636 402882.Shew185_3194 gi|153001706|ref|YP_001367387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]